PDP2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2101619
Article Name: PDP2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101619
Supplier Catalog Number: orb2101619
Alternative Catalog Number: BYT-ORB2101619-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PDP2
Conjugation: HRP
Alternative Names: PPM2B, PDPC 2, PPM2C2
PDP2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 065837
UniProt: Q9P2J9
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: CRAILGVQEDNGMWSCLPLTRDHNAWNQAELSRLKREHPESEDRTIIMED