TBC1D24 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2101641
Article Name: TBC1D24 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101641
Supplier Catalog Number: orb2101641
Alternative Catalog Number: BYT-ORB2101641-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human TBC1D24
Conjugation: FITC
Alternative Names: FIME, DEE16, DOORS, TLDC6, DFNA65, DFNB86, EIEE16, EPRPDC
TBC1D24 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 62kDa
NCBI: 065756
UniProt: Q9ULP9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SDPADRLSPFLAARHFNLPSKTESMFMAGGSDCLIVGGGGGQALYIDGDL