RHOJ Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2101647
Article Name: RHOJ Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2101647
Supplier Catalog Number: orb2101647
Alternative Catalog Number: BYT-ORB2101647-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RHOJ
Conjugation: FITC
Alternative Names: TCL, ARHJ, TC10B, RASL7B
RHOJ Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 24kDa
NCBI: 065714
UniProt: Q9ER71
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LGLYDTAGQEDYNQLRPLSYPNTDVFLICFSVVNPASYHNVQEEWVPELK