Enah Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2102124
Article Name: Enah Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102124
Supplier Catalog Number: orb2102124
Alternative Catalog Number: BYT-ORB2102124-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Enah
Conjugation: FITC
Alternative Names: Me, Nd, Mena, WBP8, Ndpp1, NDPP-1
Enah Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 84kDa
NCBI: 001076589
UniProt: E9QKR1
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RRIAEKGSTIETEQKEDRNEDAEPITAKAPSTSTPEPTRKPWERTNTMNG