ARFGAP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102126
Article Name: ARFGAP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102126
Supplier Catalog Number: orb2102126
Alternative Catalog Number: BYT-ORB2102126-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human ARFGAP1
Conjugation: HRP
Alternative Names: ARF1GAP, HRIHFB2281
ARFGAP1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 45kDa
NCBI: 060679
UniProt: Q8N6T3
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: WRDVTTFFSGKAEGPLDSPSEGHSYQNSGLDHFQNSNIDQSFWETFGSAE