Tmlhe Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102135
Article Name: Tmlhe Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102135
Supplier Catalog Number: orb2102135
Alternative Catalog Number: BYT-ORB2102135-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Rat Tmlhe
Conjugation: HRP
Alternative Names: Tmlh
Tmlhe Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 596878
UniProt: Q91ZW6
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: ELWVKLKPGKVLFIDNWRVLHGRESFTGYRQLCGCYLTRDDVLNTARILG