DPPA4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102147
Article Name: DPPA4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102147
Supplier Catalog Number: orb2102147
Alternative Catalog Number: BYT-ORB2102147-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human DPPA4
Conjugation: HRP
Alternative Names: 2410091M23Rik
DPPA4 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 33kDa
NCBI: 060659
UniProt: Q7L190
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MLRGSASSTSMEKAKGKEWTSTEKSREEDQQASNQPNSIALPGTSAKRTK