TBCCD1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102174
Article Name: TBCCD1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102174
Supplier Catalog Number: orb2102174
Alternative Catalog Number: BYT-ORB2102174-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBCCD1
Conjugation: HRP
Alternative Names: FLJ10560
TBCCD1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 060608
UniProt: Q9NVR7
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL