TBCCD1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2102175
Article Name: TBCCD1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102175
Supplier Catalog Number: orb2102175
Alternative Catalog Number: BYT-ORB2102175-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TBCCD1
Conjugation: FITC
Alternative Names: FLJ10560
TBCCD1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 060608
UniProt: Q9NVR7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: WPSPRNKSQSPDLTEKSNCHNKNWNDYSHQAFVYDHLSDLLELLLDPKQL