POP5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2102754
Article Name: POP5 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102754
Supplier Catalog Number: orb2102754
Alternative Catalog Number: BYT-ORB2102754-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human POP5
Conjugation: FITC
Alternative Names: RPP2, RPP20, hPop5, HSPC004
POP5 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 057002
UniProt: Q969H6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: KEFYQLVWSALPFITYLENKGHRYPCFFNTLHVGGTIRTCQKFLIQYNRR