Lap3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Catalog Number:
BYT-ORB2102760
| Article Name: |
Lap3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2102760 |
| Supplier Catalog Number: |
orb2102760 |
| Alternative Catalog Number: |
BYT-ORB2102760-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide corresponding to a region of Mouse |
| Conjugation: |
FITC |
| Alternative Names: |
Pe, Lap, Pep, Pep7, Peps, LAP-3, Lapep, Pep-7, Pep-S, AA410100, 2410015L10Rik |
| Lap3 Rabbit Polyclonal Antibody (FITC) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
57kDa |
| NCBI: |
077754 |
| UniProt: |
Q9CPY7 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: QDLELPSVEVDPCGDAQAAAEGAVLGLYEYDDLKQKKKVAVSAKLHGSGD |