LAP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102762
Article Name: LAP3 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102762
Supplier Catalog Number: orb2102762
Alternative Catalog Number: BYT-ORB2102762-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LAP3
Conjugation: HRP
Alternative Names: LAP, PEPS, LAPEP, HEL-S-106
LAP3 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 56kDa
NCBI: 056991
UniProt: P28838
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: LNISGPPLKAGKTRTFYGLHQDFPSVVLVGLGKKAAGIDEQENWHEGKEN