PLEKHA9 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102765
Article Name: PLEKHA9 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102765
Supplier Catalog Number: orb2102765
Alternative Catalog Number: BYT-ORB2102765-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human PLEKHA9
Conjugation: HRP
Alternative Names: FAPP2, FAPP-2, hFAPP2, PLEKHA8, PLEKHA9
PLEKHA9 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 056983
UniProt: O95397
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: EALLWLKRGLKFLKGFLTEVKNGEKDIQTALNNAYGKTLRQHHGWVVRGV