ACHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102777
Article Name: ACHE Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102777
Supplier Catalog Number: orb2102777
Alternative Catalog Number: BYT-ORB2102777-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IF, IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human ACHE
Conjugation: HRP
Alternative Names: YT, ACEE, ARACHE, N-ACHE
ACHE Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 61kDa
NCBI: 056646
UniProt: P22303
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: SMNYRVGAFGFLALPGSREAPGNVGLLDQRLALQWVQENVAAFGGDPTSV