Pfkfb2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2102957
Article Name: Pfkfb2 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2102957
Supplier Catalog Number: orb2102957
Alternative Catalog Number: BYT-ORB2102957-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Mouse
Conjugation: HRP
Alternative Names: 4930568D07Rik
Pfkfb2 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 032851
UniProt: Q6GTL7
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: RNSFTPLSSSNTIRRPRNYSVGSRPLKPLSPLRALDMQEGADQPKTQVSI