THAP12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103106
Article Name: THAP12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103106
Supplier Catalog Number: orb2103106
Alternative Catalog Number: BYT-ORB2103106-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PRKRIR
Conjugation: Biotin
Alternative Names: DAP4, THAP0, PRKRIR, P52rIPK
THAP12 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 88kDa
NCBI: 004696
UniProt: O43422
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VENCRRADLEDKTPDQLNKHYRLCAKHFETSMICRTSPYRTVLRDNAIPT