B2M Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103169
Article Name: B2M Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103169
Supplier Catalog Number: orb2103169
Alternative Catalog Number: BYT-ORB2103169-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human B2M
Conjugation: Biotin
Alternative Names: IMD43
B2M Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 004039
UniProt: P61769
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MSRSVALAVLALLSLSGLEAIQRTPKIQVYSRHPAENGKSNFLNCYVSGF