RPS6KB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2103175
| Article Name: |
RPS6KB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2103175 |
| Supplier Catalog Number: |
orb2103175 |
| Alternative Catalog Number: |
BYT-ORB2103175-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the N terminal region of human RPS6KB1 |
| Conjugation: |
Biotin |
| Alternative Names: |
S6K, PS6K, S6K1, STK14A, p70-S6K, p70 S6KA, p70-alpha, S6K-beta-1, p70(S6K)-alpha |
| RPS6KB1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
59kDa |
| NCBI: |
003152 |
| UniProt: |
P23443 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL |
