RPS6KB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103175
Article Name: RPS6KB1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103175
Supplier Catalog Number: orb2103175
Alternative Catalog Number: BYT-ORB2103175-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RPS6KB1
Conjugation: Biotin
Alternative Names: S6K, PS6K, S6K1, STK14A, p70-S6K, p70 S6KA, p70-alpha, S6K-beta-1, p70(S6K)-alpha
RPS6KB1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 003152
UniProt: P23443
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MRRRRRRDGFYPAPDFRDREAEDMAGVFDIDLDQPEDAGSEDELEEGGQL