SCP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103202
Article Name: SCP2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103202
Supplier Catalog Number: orb2103202
Alternative Catalog Number: BYT-ORB2103202-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Human SCP2
Conjugation: Biotin
Alternative Names: NLTP, SCOX, SCPX, SCP-2, SCP-X, NSL-TP, SCP-CHI
SCP2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 55kDa
NCBI: 001180529
UniProt: A6NM69
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SSPWEPATLRRVFVVGVGMTKFVKPGAENSRDYPDLAEEAGKKALADAQI