S100A9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103211
Article Name: S100A9 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103211
Supplier Catalog Number: orb2103211
Alternative Catalog Number: BYT-ORB2103211-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human S100A9
Conjugation: Biotin
Alternative Names: MIF, NIF, P14, CAGB, CFAG, CGLB, L1AG, LIAG, MRP14, 60B8AG, MAC387
S100A9 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 12kDa
NCBI: 002956
UniProt: P06702
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: DLQNFLKKENKNEKVIEHIMEDLDTNADKQLSFEEFIMLMARLTWASHEK