RANGAP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2103263
Article Name: RANGAP1 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103263
Supplier Catalog Number: orb2103263
Alternative Catalog Number: BYT-ORB2103263-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RANGAP1
Conjugation: HRP
Alternative Names: SD, Fug1, RANGAP
RANGAP1 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 002874
UniProt: P46060
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS