RANGAP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2103264
Article Name: RANGAP1 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103264
Supplier Catalog Number: orb2103264
Alternative Catalog Number: BYT-ORB2103264-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RANGAP1
Conjugation: FITC
Alternative Names: SD, Fug1, RANGAP
RANGAP1 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 63kDa
NCBI: 002874
UniProt: P46060
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDS