Ralb Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2103270
Article Name: Ralb Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103270
Supplier Catalog Number: orb2103270
Alternative Catalog Number: BYT-ORB2103270-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Mouse Ralb
Conjugation: FITC
Alternative Names: 5730472O18Rik
Ralb Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 071722
UniProt: Q9JIW9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EHESFTATAEFREQILRVKSEEDKIPLLVVGNKSDLEERRQVPVDEARGK