RAD23B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2103272
Article Name: RAD23B Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103272
Supplier Catalog Number: orb2103272
Alternative Catalog Number: BYT-ORB2103272-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RAD23B
Conjugation: HRP
Alternative Names: P58, HR23B, HHR23B
RAD23B Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 002865
UniProt: P54727
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: QMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAG