PSMB6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103340
Article Name: PSMB6 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103340
Supplier Catalog Number: orb2103340
Alternative Catalog Number: BYT-ORB2103340-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human PSMB6
Conjugation: Biotin
Alternative Names: Y, LMPY, DELTA
PSMB6 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 25kDa
NCBI: 002789
UniProt: P28072
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TTIMAVQFDGGVVLGADSRTTTGSYIANRVTDKLTPIHDRIFCCRSGSAA