MATN3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103562
Article Name: MATN3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103562
Supplier Catalog Number: orb2103562
Alternative Catalog Number: BYT-ORB2103562-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MATN3
Conjugation: Biotin
Alternative Names: HOA, OS2, EDM5, DIPOA, OADIP, SEMDBCD
MATN3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 50kDa
NCBI: 002372
UniProt: O15232
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IELYAVGVDRADMASLKMMASEPLEEHVFYVETYGVIEKLSSRFQETFCA