MAGEB4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage

Catalog Number: BYT-ORB2103569
Article Name: MAGEB4 Rabbit Polyclonal Antibody (HRP) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103569
Supplier Catalog Number: orb2103569
Alternative Catalog Number: BYT-ORB2103569-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MAGEB4
Conjugation: HRP
Alternative Names: CT3.6
MAGEB4 Rabbit Polyclonal Antibody (HRP)
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 002358
UniProt: O15481
Buffer: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Form: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Sequence: Synthetic peptide located within the following region: KEESPSSSSSVLRDTASSSLAFGIPQEPQREPPTTSAAAAMSCTGSDKGD