MPP3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage

Catalog Number: BYT-ORB2103585
Article Name: MPP3 Rabbit Polyclonal Antibody (FITC) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103585
Supplier Catalog Number: orb2103585
Alternative Catalog Number: BYT-ORB2103585-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MPP3
Conjugation: FITC
Alternative Names: DLG3
MPP3 Rabbit Polyclonal Antibody (FITC)
Clonality: Polyclonal
Molecular Weight: 66kDa
NCBI: 001923
UniProt: Q13368
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GVEYHFVSKQAFEADLHHNKFLEHGEYKENLYGTSLEAIQAVMAKNKVCL