RPL37A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2103961
Article Name: RPL37A Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2103961
Supplier Catalog Number: orb2103961
Alternative Catalog Number: BYT-ORB2103961-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RPL37A
Conjugation: Biotin
Alternative Names: L37A
RPL37A Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 10kDa
NCBI: 000989
UniProt: P61513
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: CGKTKMKRRAVGIWHCGSCMKTVAGGAWTYNTTSAVTVKSAIRRLKELKD