RSPH10B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104111
Article Name: RSPH10B Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104111
Supplier Catalog Number: orb2104111
Alternative Catalog Number: BYT-ORB2104111-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human RSPH10B
Conjugation: Biotin
Alternative Names: MGC50833, RSPH10B2
RSPH10B Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 96kDa
NCBI: 775836
UniProt: B2RC85
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EFVNGYRHGRGKFYYASGAMYDGEWVSNKKHGMGRLTFKNGRVYEGAFSN