MGC50273 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104117
Article Name: MGC50273 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104117
Supplier Catalog Number: orb2104117
Alternative Catalog Number: BYT-ORB2104117-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MGC50273
Conjugation: Biotin
Alternative Names: C2orf27B
MGC50273 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 999626
UniProt: Q580R0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MFVRPESGEQGPETLAPASGAEIQRFPVPAVEPVPAPGADSPPGTALELE