ERVFRD-1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104141
Article Name: ERVFRD-1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104141
Supplier Catalog Number: orb2104141
Alternative Catalog Number: BYT-ORB2104141-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human ERVFRD-1
Conjugation: Biotin
Alternative Names: envFRD, UNQ6191, ERVFRDE1, GLLL6191, HERV-FRD, HERV-W/FRD
ERVFRD-1 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 59kDa
NCBI: 997465
UniProt: P60508
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: PLVSLLLLLLFGPCLLNLITQFVSSRLQAIKLQTNLSAGRHPRNIQESPF