LRRC33 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104297
Article Name: LRRC33 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104297
Supplier Catalog Number: orb2104297
Alternative Catalog Number: BYT-ORB2104297-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human LRRC33
Conjugation: Biotin
Alternative Names: GARPL1, LRRC33, SENEBAC, UNQ3030, ELLP3030
LRRC33 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 76kDa
NCBI: 940967
UniProt: Q86YC3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GLERLRELDLQRNYIFEIEGGAFDGLAELRHLNLAFNNLPCIVDFGLTRL