Tmem110 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104300
Article Name: Tmem110 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104300
Supplier Catalog Number: orb2104300
Alternative Catalog Number: BYT-ORB2104300-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide corresponding to a region of Rat
Conjugation: Biotin
Alternative Names: Tmem110
Tmem110 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 32kDa
NCBI: 942069
UniProt: Q3UF25
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VGQCALYIVIMIFEKSVVFIVLLILQWKKVALLNPIENPDLKLAIVMLIV