C3orf62 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104306
Article Name: C3orf62 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104306
Supplier Catalog Number: orb2104306
Alternative Catalog Number: BYT-ORB2104306-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C3orf62
Conjugation: Biotin
Alternative Names: MAPS
C3orf62 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 940964
UniProt: Q6ZUJ4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: IDHTSIRTIEELAGKIEFENELNHMCGHCQDSPFKEEAWALLMDKSPQKA