CATIP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104309
Article Name: CATIP Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104309
Supplier Catalog Number: orb2104309
Alternative Catalog Number: BYT-ORB2104309-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human C2orf62
Conjugation: Biotin
Alternative Names: C2orf62
CATIP Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 44kDa
NCBI: 940961
UniProt: Q7Z7H3
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: FLLFLLLRQPEDVVTFAAEFFGPFDPWRPSSPALGSSHRPNPFRSLEPEG