Hddc3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104321
Article Name: Hddc3 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104321
Supplier Catalog Number: orb2104321
Alternative Catalog Number: BYT-ORB2104321-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Rat Hddc3
Conjugation: Biotin
Alternative Names: RGD1311839
Hddc3 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 19kDa
NCBI: 001100998
UniProt: D4A500
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EVELHFGAQVRRLVEEVTDDKTLPKLERKRQQVEQAPHSSPGAKLVKLAD