WDR53 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104417
Article Name: WDR53 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104417
Supplier Catalog Number: orb2104417
Alternative Catalog Number: BYT-ORB2104417-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human WDR53
Conjugation: Biotin
Alternative Names: MGC64882
WDR53 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 872433
UniProt: Q7Z5U6
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: NLLASADDSGAIKILDLENKKVIRSLKRHSNICSSVAFRPQRPQSLVSCG