FAM131C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104420
Article Name: FAM131C Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104420
Supplier Catalog Number: orb2104420
Alternative Catalog Number: BYT-ORB2104420-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human FAM131C
Conjugation: Biotin
Alternative Names: C1orf117
FAM131C Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 30kDa
NCBI: 872429
UniProt: Q96AQ9
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: RGRVAHLIEWKGWSAQPAGWELSPAEDEHYCCLPDELREARFAAGVAEQF