USP12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104456
Article Name: USP12 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104456
Supplier Catalog Number: orb2104456
Alternative Catalog Number: BYT-ORB2104456-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human USP12
Conjugation: Biotin
Alternative Names: UBH1, USP12L1
USP12 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 43kDa
NCBI: 872294
UniProt: O75317
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ITRLRKENELFDNYMQQDAHEFLNYLLNTIADILQEERKQEKQNGRLPNG