CCDC190 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104528
Article Name: CCDC190 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104528
Supplier Catalog Number: orb2104528
Alternative Catalog Number: BYT-ORB2104528-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C1orf110
Conjugation: Biotin
Alternative Names: C1orf110
CCDC190 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 34kDa
NCBI: 848645
UniProt: Q86UF4
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: SKARNAHYLRHRVPPESERLLSIGEIFGHGESSSSRAGKECENRVPSKFL