Cyp4x1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Catalog Number:
BYT-ORB2104549
| Article Name: |
Cyp4x1 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage |
| Biozol Catalog Number: |
BYT-ORB2104549 |
| Supplier Catalog Number: |
orb2104549 |
| Alternative Catalog Number: |
BYT-ORB2104549-100 |
| Manufacturer: |
Biorbyt |
| Host: |
Rabbit |
| Category: |
Antikörper |
| Application: |
WB |
| Immunogen: |
The immunogen is a synthetic peptide directed towards the C-terminal region of Mouse Cyp4x1 |
| Conjugation: |
Biotin |
| Alternative Names: |
CYP_a, Cyp4a2, CYPIVX1, A230025G20, Cyp4a28-ps |
| Cyp4x1 Rabbit Polyclonal Antibody (Biotin) |
| Clonality: |
Polyclonal |
| Molecular Weight: |
58kDa |
| NCBI: |
001003947 |
| UniProt: |
Q6A152 |
| Buffer: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Form: |
Liquid. Purified antibody supplied in 1x PBS buffer. |
| Sequence: |
Synthetic peptide located within the following region: GMTVVLSIWGLHHNPAVWNDPKVFDPLRFTKENSDQRHPCAFLPFSSGPR |
