RHOC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104582
Article Name: RHOC Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104582
Supplier Catalog Number: orb2104582
Alternative Catalog Number: BYT-ORB2104582-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: IHC, WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RHOC
Conjugation: Biotin
Alternative Names: H9, ARH9, ARHC, RHOH9
RHOC Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 22kDa
NCBI: 786886
UniProt: P08134
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: VPTVFENYIADIEVDGKQVELALWDTAGQEDYDRLRPLSYPDTDVILMCF