C11orf77 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104633
Article Name: C11orf77 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104633
Supplier Catalog Number: orb2104633
Alternative Catalog Number: BYT-ORB2104633-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C11orf77
Conjugation: Biotin
Alternative Names: C11orf77
C11orf77 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 39kDa
NCBI: 776172
UniProt: Q96MB7
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: GVMGVVDCIHVAIKAPNAEDLSYVNRKGLHSLNCLMVCDIRGTLMTVETN