C16orf65 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104651
Article Name: C16orf65 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104651
Supplier Catalog Number: orb2104651
Alternative Catalog Number: BYT-ORB2104651-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C16orf65
Conjugation: Biotin
Alternative Names: C16orf65
C16orf65 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 23kDa
NCBI: 776167
UniProt: Q8IXQ8
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: TSTPKKIELAKDESFTSSDDNENVDLDKRLQYYRYPWSTVHHPARRPISI