C9orf75 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104657
Article Name: C9orf75 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104657
Supplier Catalog Number: orb2104657
Alternative Catalog Number: BYT-ORB2104657-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C9orf75
Conjugation: Biotin
Alternative Names: DFNB79, C9orf75
C9orf75 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 47kDa
NCBI: 775962
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: EAMVRCGGVERWGESDTRASPCVHILSSHFQLTPASQNDLSDFRSEPALY