C6orf146 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104720
Article Name: C6orf146 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104720
Supplier Catalog Number: orb2104720
Alternative Catalog Number: BYT-ORB2104720-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human C6orf146
Conjugation: Biotin
Alternative Names: C6orf146
C6orf146 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 57kDa
NCBI: 775834
UniProt: Q8IXS0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: ETLPAPNWNLKHGNSSVEENFTDESDLSENEKTNDTLLSYFKKVDLNLKP