TMEM146 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104855
Article Name: TMEM146 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104855
Supplier Catalog Number: orb2104855
Alternative Catalog Number: BYT-ORB2104855-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human TMEM146
Conjugation: Biotin
Alternative Names: TMEM146
TMEM146 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 90kDa
NCBI: 689997
UniProt: Q86XM0
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: LIQDVQGDRLYFHPTTTRLIKHPCEKNIALYLGKQVFFTMDNFETSLLPF