CCDC197 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104864
Article Name: CCDC197 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104864
Supplier Catalog Number: orb2104864
Alternative Catalog Number: BYT-ORB2104864-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human C14orf48
Conjugation: Biotin
Alternative Names: C14orf48, c14_5713, LINC00521
CCDC197 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 16kDa
NCBI: 689990
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: MDTGQRADPSNPGDKEGDLQGLWQELYQLQAKQKKLKREVEKHKLFEDYL