Cpne2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage

Catalog Number: BYT-ORB2104921
Article Name: Cpne2 Rabbit Polyclonal Antibody (Biotin) Preis auf Anfrage
Biozol Catalog Number: BYT-ORB2104921
Supplier Catalog Number: orb2104921
Alternative Catalog Number: BYT-ORB2104921-100
Manufacturer: Biorbyt
Host: Rabbit
Category: Antikörper
Application: WB
Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of Mouse Cpne2
Conjugation: Biotin
Alternative Names: 3322401K10Rik
Cpne2 Rabbit Polyclonal Antibody (Biotin)
Clonality: Polyclonal
Molecular Weight: 60kDa
NCBI: 705727
UniProt: P59108
Buffer: Liquid. Purified antibody supplied in 1x PBS buffer.
Form: Liquid. Purified antibody supplied in 1x PBS buffer.
Sequence: Synthetic peptide located within the following region: QCCVCKVELSVSGQNLLDRDVTSKSDPFCVLFIEDNGRWMEFDRTETAVN